PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7NG164300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MYB_related
Protein Properties Length: 1685aa    MW: 181993 Da    PI: 6.5313
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7NG164300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.42.2e-10805847347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          +WT+eE e++ +  +++G++ +++I++ +  ++t  +c+++++k+
  Pavir.7NG164300.1.p 805 PWTQEEKEIFMEMLAKFGKD-FSKISSLLV-HKTTADCVEFYYKH 847
                          8*****************99.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.98E-14790850IPR009057Homeodomain-like
PROSITE profilePS5129315.735801852IPR017884SANT domain
SMARTSM007171.4E-10802850IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-8803849IPR009057Homeodomain-like
PfamPF002494.1E-8804847IPR001005SANT/Myb domain
PROSITE profilePS5129312.20410101061IPR017884SANT domain
SMARTSM007171.3E-410111059IPR001005SANT/Myb domain
SuperFamilySSF466891.48E-810141061IPR009057Homeodomain-like
CDDcd001670.0028610151053No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1685 aa     Download sequence    Send to blast
MPPPPPDRRD YLYREGRRHD GGGGGEPLLP PAPTPPRWRD SPYHPPPPPL RDHARPSPRR  60
APPSASSEGY YRQGGGAYDR SFPDEPPIGH TPSRSDRYWA EDDGGGCKGF GRYGGGGRRD  120
GRDMRGSYRR SPFRGYGSDI SRNHTEQPPP PPPRRSPLRS VAVPICYDPP GNRVDKGDRD  180
NLARVTPWRR RESRSEIADA AGAGPVSVGQ TNRPAPSEKA SAQPLAGAAP HGADEEAPRK  240
KARLGWGQGL AKYEKQKVQG PADLAEAVVD GSPADTEQKA AFPVPPPEPP AAPAPPPEPP  300
AAPEPPAPAP VPPAAPASAA VYVPASVSAS SPARCTSPVD APSSAAPFCT SGPEDKSCEQ  360
TANTVINPTK DVPEAGDKTF NNEFSIKLDQ LGDDPINSLA NMLADVLQHD DSCSGDSKGP  420
TSASKLLLLK ESISKEIEKT ELEIDLLEGE LKSVNSEAGT AAEGSPTGVT YAENISPSSG  480
TSKVPVSVEI SETSHVMKEP GELISSPKPP SVQDVDAKGS DMMEIETAPV RNAKTVSSEE  540
SAVSPVVAED PACAAAVLSP LKASEGAGSQ IDMHNDRLET SPCHDNAESI KTEVSDDPPV  600
RQCPHHDHKY SLFGSVTSAN NNIAKVMNES LFKSLPADTL HLDLVAPSHH LSQSKNDHRI  660
KERLGVFKNR LRLKEQILTL KFKAYRHLWK EDLRLLSAKK QRSKSNKRID QSNRASHIGS  720
QRQRSSNRSR LAMPAGNLSI FLTPEMSDVA SKLFSEFQIK RCRNYLKMPA LIIDEREKEC  780
LRFASKNSMV DDPVLVEKER VMINPWTQEE KEIFMEMLAK FGKDFSKISS LLVHKTTADC  840
VEFYYKHHKS DSFREVKKLL DLRQHQPTGN FLGAKSGKKW NPEANAASLD MLGVASVVAA  900
HGLEYANRVE KVSAKSLIRA AYGSNASFAA KKSSDRECIN NAPLNERESV AADVLAGICG  960
TLSPEGMGSC ITSSADLGKI SMTRMEHILA PEFDRSIDEE DSLSDEECEV DPVDWNDNEK  1020
SIFIEAMNNY GKDFARISSC VKSKSYEQCK VFFSKARKSL GLDLIHQGAA DVSVPTSDTN  1080
GGRSDTDEAC AAEMDSAICS TQSCSKIEMV CPTEKDIGGI ITKQPELNIS NGFDVVNSKT  1140
GEDEKKTEKK CGIVDHERFD EGTHQAACGP IDINCPESTE KLHGKDDVID QVNMHNNSAI  1200
SSSTEQAKAV PSEVQSCLDS VEVLHQTSKS PLGTGTDASQ MEECSNHALD DKLMKAGNSG  1260
ASSCIASDKC IRDNVHFANT ISPTFASSYK HSVPADMPPT KPKPLVTPLT PKDLMPVQFS  1320
SAVPDPTAIR FDGIASITMP NFEDSGNRVS SSLGPKDMSK YPAFKDPTGN QHVTLFRNVD  1380
GYTNHLTTEL PIFSERTASG TVSTSQTDRF TLTKFQNGRS SSLGLPNTSD GIQWARKHEE  1440
VLQGSLRSCS HNTSSDGDEQ QKRPGDVKLF GKILSHQSSL QSSVSSCNGN KSKPPSPKVD  1500
TSSVRLSNNP RDRVVCSSRP GFTHLGLEER TARSYGHLDG STTQPEPLLM MAKCQSLAGV  1560
PFYSAKNGTV SVFSDYQQPS IQPHQSDPKR LERFSDPQKR NGMEFISGFQ QPGKISRFGG  1620
AGILVSGVSD PVAALKAQYG PSSKVMGSDV DPWKDIGSSS IPFASLTCQQ WHSAVGSLEV  1680
LSTG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1698704KKQRSKS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.32510.0callus| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960366.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
RefseqXP_004960367.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
RefseqXP_012700232.10.0PREDICTED: uncharacterized protein LOC101781442 isoform X1
TrEMBLK3Z3350.0K3Z335_SETIT; Uncharacterized protein
STRINGSi020953m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62993549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.13e-77MYB family protein